| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
(Hypertension. 2003;41:751.)
© 2003 American Heart Association, Inc.
Scientific Contributions |
From the Department of Physiology and Functional Genomics and the University of Florida, McKnight Brain Institute, Gainesville.
Correspondence to Mohan K. Raizada, PhD, Professor, Department of Physiology and Functional Genomics, PO Box 100274, University of Florida, College of Medicine, Gainesville, FL 32610. E-mail mraizada{at}phys.med.ufl.edu
| Abstract |
|---|
|
|
|---|
Key Words: receptors, angiotensin II protein kinases transduction technology
| Introduction |
|---|
|
|
|---|
Recently, a new technology involving the use of protein transduction domains (PTDs) has been developed as an alternative for an efficient delivery of protein in vivo.20 It is based on the observation that an 11-amino-acid sequence from the HIV-Tat protein possesses the ability to transport any protein linked to it across the plasma membrane.21,22 This has enabled investigators to deliver large proteins, including receptors and enzymes, into cells under physiological conditions.23 Thus, fusion of PTDs to a functional protein dramatically increases its bioavailability in the cell and opens the possibility of studying the structuralfunctional aspects in an in vivo physiological setting.24,25 In the present study, we used this protein transduction technology to determine whether a functional domain of the AT1R can be delivered into neurons while retaining its cellular actions. We have chosen the third intracellular loop (3IL) of the AT1R for this "proof of concept." The rationale for it is based on our previous observation that this domain, when microinjected into a neuron, mimics the effects of Ang II of K+ and Ca2+ currents.26 The data for the present study provide direct evidence that the HIV-Tat-PTDmediated transfer of protein can be used for in vivo studies.
| Methods |
|---|
|
|
|---|
Construction of Vectors to Express HIV-Tat-PTD N-Terminal and EGFP C-Terminal Fusions
An outline of our cloning strategy and protein expression is shown in Figure 1. The amino acid sequence that corresponds to the HIV-Tat-PTD was flanked by glycine residues to increase flexibility of the protein fusion (GYGRKKRRQRRG).27 This was reverse translated and used to design an oligonucleotide with an in-frame N-terminal fusion with EGFP, and it possessed a unique BglII site separating both HIV-Tat-PTD and EGFP sequences to allow in-frame fusions of another protein with the PTD and the reporter gene. The primers for this polymerase chain reaction (PCR) were as follows: HIV-Tat-PTD-EGFP (F), 5'-CATATGGGTTATGGCAG GAAGAAGCGGAGACAGCGACGAGGTAGATCTATGGTG AG-3'; EGFP (R), 5'-CGCTTTACTTGTACAGCTCGTC-3'. The PCRs were performed in the presence of 20 mmol/L Tris HCl (pH 8.8), 2 mmol/L MgSO4, 10 mmol/L KCl, 10 mmol/L (NH4)2SO4, 0.1% Triton X-100 and 0.1 mg/mL nuclease-free BSA mediated by Pfu polymerase. The PCR product was gel purified and cloned into the NdeIXhoI sites of pET15-b to create the HIV-Tat-PTD-EGFP-pET15-b protein expression vector, which also provides an N-terminal 6 histidine tag to facilitate protein purification.
|
The amino acid sequence WKALKKAYKIQKNTPRNDDIFR from the AT1bR 3IL W219-R240 was reverse translated and used to design complementary overlapping oligonucleotides. The primer sequences included a BglII site (underlined) and were as follows: AT1bR 3IL (F), 5'-AGAGATCTTGGAAAG CTCTAAAGAAGGCTTATAAAATTC AGAAGAA-3'; AT1bR 3IL (R), 5'-CTAGATCT CCTAAAGATGTCATCATTTCTTGGCGT GTTCT-TCTGAATT-3'. PCR was performed under the conditions previously mentioned, and the product was gel purified and cloned into the BglII site in HIV-Tat-PTD-EGFP-pET15-b. The identity of the clones was confirmed by DNA sequencing.
Protein Expression and Purification
Recombinant proteins were expressed in Escherichia coli BL21 (DE3) by conventional protocols. The proteins were extracted following a modification of the protocol described by Vocero-Akbani et al,23 in which the urea was removed by dialysis against PBS.
Synthetic Peptides
In the design of the synthetic peptide, we included some modifications to the HIV-Tat-PTD that optimized the
-helical content and optimized the placement of arginine residues, enhancing the transduction potential of this PTD.28 The amino acid sequence of the PTD-AT1bR 3IL was YARAAARQARAGWKALKKAY KIQKNTPRNDDIFR, and the sequence of the PTD-scrambled peptide was YARAAARQARAGNKPFANRIWYKDKLTKIDKRAQ. The PTD sequence is shown underlined.
Peptides were synthesized by solid phase with 9-fluorenylmethoxycarbonyl (FMOC) chemistry in an Applied Biosystems Peptide Synthesizer (Protein Core Facility of the ICBR, University of Florida). Each peptide was purified to >95% by high-performance liquid chromatography and analyzed by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.
Preparation of Neuronal Cultures
Neuronal co-cultures were prepared from the hypothalamus and brainstem of 1-day-old WKY as previously described.29 At the time of use, cultures consisted of 90% neurons and 10% astrocyte glia, as determined by immunofluorescent staining with antibodies against neurofilament proteins and glial fibrillary acidic protein. Unless noted, experiments were performed using WKY neuronal cultures.
Transduction of HIV-Tat Fusion Proteins Into Neurons
To evaluate the ability of the recombinant HIV-Tat fusion proteins to transduce into neurons, different concentrations of HIV-Tat-EGFP (PTD-EGFP) and HIV-Tat-AT1bR 3IL-EGFP (PTD-3IL-EGFP) were added to the culture media of neuronal co-cultures from 1-day-old rat brain. After different incubation times, the media was removed, and the plates were washed once with PBS for fluorescent microscopic examination.
Electrophysiological Recordings
Spontaneous action potentials in neuronal cultures were recorded with the use of the whole-cell voltage clamp configuration30 in current clamp mode as described previously.31
Data Analysis
Results were expressed as mean±SE. Statistical significance was evaluated with the use of a 1-way ANOVA followed by a Newman-Keuls test. Differences were considered significant at P<0.05.
| Results |
|---|
|
|
|---|
|
Transduction of TAT-PTD-AT1b-R 3IL-EGFP Increases Neuronal Firing Rate
Spontaneous action potentials presented by the neurons were of a random burstfiring pattern. Stimulation with Ang II (100 nmol/L) superfusion caused an increase in firing rate from 0.4±0.1 to 1.4±0.5 Hz.32 Similar to Ang II, superfusion with PTD-3IL-EGFP (7.8 µg/mL) recombinant protein resulted in an increase in the firing rate within 1 to 2 minutes, from 0.46±0.05 to 1.27±0.29 Hz. Such an increase was not observed when TAT-PTD-EGFP (7.8 µg/mL; control protein) was used in the superfusate (Figure 3). In addition, a lower dose of PTD-3IL-EGFP (3.5 µg/mL) stimulated only a 48% increase in firing rate compared with that of the 7.8 µg/mL dose.
|
Having established the transduction efficacy and functional effects on the neurons, we next determined if the synthetic PTD-AT1bR 3IL protein would mimic the stimulation of firing rate observed with the recombinant protein. The rationale for this approach was as follows: (1) the synthetic peptide allows one to perform modifications on the desired protein with relative ease without undergoing site-directed mutagenesis, cloning, and sequencing as required for the recombinant protein; and (2) it permits us to decrease the size of the transducible protein. Figure 4 shows that superfusion of neuronal cultures with 7.8 µg/mL PTD-3IL caused an increase in the spontaneous firing rate, from 0.59±0.17 to 1.42±0.37 Hz. A scrambled amino acid sequence of the AT1bR 3IL fused to PTD (7.8 µg/mL) was without any significant effect on the firing rate (Figure 4).
|
PTD-3IL Stimulation of Firing Rate Involves Protein Kinase C Signaling
Our previous studies have demonstrated that the AT1R-mediated stimulation of neuronal firing rate was partially mediated by the activation of protein kinase C (PKC) signaling.32 We determined the effect of PKC inhibition on the PTD-AT1bR 3ILmediated stimulation of neuronal firing rate. This was performed in an attempt to determine the specificity of this peptide to mimic AT1R function. Neurons were superfused with the PKC inhibitor calphostin C (10 µmol/L) under the conditions that inhibit PKC-dependent firing rate of Ang II.32 In the presence of calphostin C, PTD-3IL did not alter neuronal firing rate (Figure 5).
|
| Discussion |
|---|
|
|
|---|
Our previous studies have demonstrated that Ang II increases neuronal firing rate via AT1R-mediated increases in Ca2+ current and decreases in K+ currents.33 These actions involve the 3IL of this receptor subtype.26 In the present study, we used these properties of the 3IL to determine the efficacy of the HIV-Tat-PTD system. We were able to mimic the stimulatory action of Ang II on firing rate by combining the AT1bR 3IL with the Tat-PTD. The resulting protein was freely diffusible across the plasma membrane into the neurons without any apparent toxicity. As a result, it mimicked the action of Ang II on neuronal firing rate. This stimulation was specific and identical to that observed by Ang II activation of the neuronal AT1R: (1) scrambled peptide or EGFP coupled to a PTD did not stimulate firing rates, (2) synthetic and recombinant PTD-3IL were equally effective, and (3) increase of firing rate by PTD-3IL was partially inhibited by inhibition of PKC. A similar inhibition of Ang IIinduced firing rate has been previously established for these neurons.32 This indicated that like Ang II, PTD-3IL uses the PKC signaling pathway to stimulate neuronal firing.
The AT1R mediates diverse physiological actions of Ang II.2,34,35 Thus, the specificity of these actions must reside in various structural domains of the receptor and their interactions with intracellular signaling molecules. So far, studies have relied on the use of genetic approaches when deleted, chimeric, or mutated cDNA sequences have been used in transient expression assays in vitro in an attempt to characterize various functional domains of the AT1R.9-13,36 An alternative to this approach has been to use synthetic peptides for intracellular injections to study cellular functions.14,26 Both these methods have met with limited success for in vivo studies because of their inability to be used in physiological settings. The present study presents an alternative approach in which combination of a putative functional domain of the AT1R fused to a PTD enables it to be freely transported through the membrane and into the cell.
Neuronal cells transduced with PTD-3IL-EGFP showed that the cells took up the protein in minutes. It was predominantly localized into the cytoplasmic compartment but began to localize into the nuclear compartment during 1-hour incubation. This observation is not surprising because HIV-Tat contains a nuclear localization signal.37 However, it raises some very interesting questions. For example, does nuclear targeting of the AT1bR 3IL play any role on neuronal firing rate on a long-term basis? It would be interesting to determine if AT1bR 3IL exerts long-lasting effects on firing rate. It is possible that cytoplasmic targeting of the AT1bR 3IL is linked to one set of responses (eg, stimulation of firing rate, neurotransmitter release), whereas its nuclear targeting regulates chronic responses of Ang II. There is some evidence for nuclear targeting of the AT1R in hepatocytes and in neurons.3840 These are relevant issues that are easily resolved by the mutation of the nuclear localization signal of HIV-Tat-PTD, which would result in its exclusion from the nucleus and accumulation in the cytoplasmic compartment only.
Perspectives
Our research group has extensibly used AT1bR antisense to attenuate AT1R function. Thus, the rationale for using AT1bR subtype in this study was our anticipated expectation to study which physiological actions of Ang II attenuated by the AT1b antisense could be restored by the AT1b 3IL. We believe that the use of PTDs presents a valuable tool to explore the molecular mechanism both in vitro and in vivo, and this study has put us in a position to test the AT1R structurefunction in vivo. In fact, examples already exist for the use of this technology in vivo and in whole-animal situations.25,28,41,42
| Acknowledgments |
|---|
| Footnotes |
|---|
Received October 1, 2002; first decision October 25, 2002; accepted November 6, 2002.
| References |
|---|
|
|
|---|
2. DiBona GF. Peripheral and central interactions between the renin-angiotensin system and the renal sympathetic nerves in control of renal function. Ann N Y Acad Sci. 2001; 940: 395406.[Medline] [Order article via Infotrieve]
3. Inagami T, Iwai N, Sasaki K, Yamamo Y, Bardhan S, Chaki S, Guo DF, Furuta H. Cloning, expression and regulation of angiotensin II receptors. J Hypertens. 1992; 10: 713716.[Medline] [Order article via Infotrieve]
4. Iwai N, Yamano Y, Chaki S, Konishi F, Bardhan S, Tibbetts C, Sasaki K, Hasegawa M, Matsuda Y, Inagami T. Rat angiotensin II receptor: cDNA sequence and regulation of the gene expression. Biochem Biophys Res Commun. 1991; 177: 299304.[CrossRef][Medline] [Order article via Infotrieve]
5. Murphy TJ, Alexander RW, Griendling KK, Runge MS, Bernstein KE. Isolation of a cDNA encoding the vascular type-1 angiotensin II receptor. Nature. 1991; 351: 233236.[CrossRef][Medline] [Order article via Infotrieve]
6. Sasaki K, Yamano Y, Bardhan S, Iwai N, Murray JJ, Hasegawa M, Matsuda Y, Inagami T. Cloning and expression of a complementary DNA encoding a bovine adrenal angiotensin II type-1 receptor. Nature. 1991; 351: 230233.[CrossRef][Medline] [Order article via Infotrieve]
7. Schmitz U, Thommes K, Beier I, Wagner W, Sachinidis A, Dusing R, Vetter H. Angiotensin IIinduced stimulation of p21-activated kinase and c-Jun NH2-terminal kinase is mediated by Rac1 and Nck. J Biol Chem. 2001; 276: 220032210.
8. Venema RC, Ju H, Venema VJ, Schieffer B, Harp JB, Ling BN, Eaton DC, Marrero MB. Angiotensin IIinduced association of phospholipase C
1 with the G proteincoupled AT1 receptor. J Biol Chem. 1998; 273: 77037708.
9. Zhang M, Zhao X, Chen HC, Catt KJ, Hunyady L. Activation of the AT1 angiotensin receptor is dependent on adjacent apolar residues in the carboxyl terminus of the third cytoplasmic loop. J Biol Chem. 2000; 275: 1578215788.
10. Conchon S, Miserey S, Parnot C, Monnot C, Corvol P, Clauser E. Several interesting phenotypes of the AT1 receptor produced by site-directed mutagenesis. J Am Soc Nephrol. 1999; 10 (suppl 11): S8S14.[Medline] [Order article via Infotrieve]
11. Wang C, Jayadev S, Escobedo JA. Identification of a domain in the angiotensin II type 1 receptor determining Gq coupling by the use of receptor chimeras. J Biol Chem. 1995; 270: 1667716682.
12. Miura S, Zhang J, Karnik SS. Angiotensin II type 1 receptor function affected by mutations in cytoplasmic loop CD. FEBS Lett. 2000; 470: 331335.[CrossRef][Medline] [Order article via Infotrieve]
13. Sano T, Ohyama K, Yamano Y, Nakagomi Y, Nakazawa S, Kikyo M, Shirai H, Blank JS, Exton JH, Inagami T. A domain for G protein coupling in carboxyl-terminal tail of rat angiotensin II receptor type 1A. J Biol Chem. 1997; 272: 2363123636.
14. Shirai H, Takahashi K, Katada T, Inagami T. Mapping of G protein coupling sites of the angiotensin II type 1 receptor. Hypertension. 1995; 25: 726730.
15. Han H, Hoffmann S, Hu K, Ertl G. Angiotensin II subtype 1 (AT1) receptors contribute to ischemic contracture and regulate chemomechanical energy transduction in isolated transgenic rat (
MHC-hAT1)594-17 hearts. Eur J Heart Fail. 2002; 4: 131137.[CrossRef][Medline]
[Order article via Infotrieve]
16. Lazartigues E, Dunlay SM, Loihl AK, Sinnayah P, Lang JA, Espelund JJ, Sigmund CD, Davisson RL. Brain-selective overexpression of angiotensin (AT1) receptors causes enhanced cardiovascular sensitivity in transgenic mice. Circ Res. 2002; 90: 617624.
17. Hoffmann S, Krause T, van Geel PP, Willenbrock R, Pagel I, Pinto YM, Buikema H, van Gilst WH, Lindschau C, Paul M, Inagami T, Ganten D, Urata H. Overexpression of the human angiotensin II type 1 receptor in the rat heart augments load induced cardiac hypertrophy. J Mol Med. 2001; 79: 601608.[CrossRef][Medline] [Order article via Infotrieve]
18. Hein L, Stevens ME, Barsh GS, Pratt RE, Kobilka BK, Dzau VJ. Overexpression of angiotensin AT1 receptor transgene in the mouse myocardium produces a lethal phenotype associated with myocyte hyperplasia and heart block. Proc Natl Acad Sci U S A. 1997; 94: 63916396.
19. Nickenig G, Laufs U, Schnabel P, Knorr A, Paul M, Bohm MP. Downregulation of aortic and cardiac AT1 receptor gene expression in transgenic (mRen-2) 27 rats. Br J Pharmacol. 1997; 121: 134140.[CrossRef][Medline] [Order article via Infotrieve]
20. Wadia JS, Dowdy SF. Protein transduction technology. Curr Opin Biotechnol. 2002; 13: 5256.[CrossRef][Medline] [Order article via Infotrieve]
21. Frankel AD, Pabo CO. Cellular uptake of the tat protein from human immunodeficiency virus. Cell. 1988; 55: 11891193.[CrossRef][Medline] [Order article via Infotrieve]
22. Green M, Loewenstein PM. Autonomous functional domains of chemically synthesized human immunodeficiency virus tat trans-activator protein. Cell. 1988; 55: 11791188.[CrossRef][Medline] [Order article via Infotrieve]
23. Vocero-Akbani A, Chellaiah MA, Hruska KA, Dowdy SF. Protein transduction: delivery of Tat-GTPase fusion proteins into mammalian cells. Methods Enzymol. 2001; 332: 3649.[Medline] [Order article via Infotrieve]
24. Cao G, Pei W, Ge H, Liang Q, Luo Y, Sharp FR, Lu A, Ran R, Graham SH, Chen J. In vivo delivery of a BclXL fusion protein containing the TAT protein transduction domain protects against ischemic brain injury and neuronal apoptosis. J Neurosci. 2002; 22: 54235431.
25. Xia H, Mao Q, Davidson BL. The HIV Tat protein transduction domain improves the biodistribution of ß-glucuronidase expressed from recombinant viral vectors. Nat Biotechnol. 2001; 19: 640644.[CrossRef][Medline] [Order article via Infotrieve]
26. Zhu M, Neubig RR, Wade SM, Posner P, Gelband CH, Sumners C. Modulation of K+ and Ca2+ currents in cultured neurons by an angiotensin II type 1a receptor peptide. Am J Physiol. 1997; 273: C1040C1048.[Medline] [Order article via Infotrieve]
27. Nagahara H, Vocero-Akbani AM, Snyder EL, Ho A, Latham DG, Lissy NA, Becker-Hapak M, Ezhevsky SA, Dowdy SF. Transduction of full-length TAT fusion proteins into mammalian cells: TAT-p27Kip1 induces cell migration. Nat Med. 1998; 4: 14491452.[CrossRef][Medline] [Order article via Infotrieve]
28. Ho A, Schwarze SR, Mermelstein SJ, Waksman G, Dowdy SF. Synthetic protein transduction domains: enhanced transduction potential in vitro and in vivo. Cancer Res. 2001; 61: 474477.
29. Raizada MK, Muther TF, Sumners C. Increased angiotensin II receptors in neuronal cultures from hypertensive rat brain. Am J Physiol. 1984; 247: C364C372.[Medline] [Order article via Infotrieve]
30. Hamill OP, Marty A, Neher E, Sakmann B, Sigworth FJ. Improved patch-clamp techniques for high-resolution current recording from cells and cell-free membrane patches. Pflugers Arch. 1981; 391: 85100.[CrossRef][Medline] [Order article via Infotrieve]
31. Zhu M, Sumners C, Gelband CH, Posner P. Chronotropic effect of angiotensin II via type 2 receptors in rat brain neurons. J Neurophysiol. 2001; 85: 21772183.
32. Sun C, Sumners C, Raizada MK. Chronotropic action of angiotensin II in neurons via protein kinase C and CaMKII. Hypertension. 2002; 39: 562566.
33. Sumners C, Zhu M, Gelband CH, Posner P. Angiotensin II type 1 receptor modulation of neuronal K+ and Ca2+ currents: intracellular mechanisms. Am J Physiol. 1996; 271: C154C163.[Medline] [Order article via Infotrieve]
34. Arendshorst WJ, Brannstrom K, Ruan X. Actions of angiotensin II on the renal microvasculature. J Am Soc Nephrol. 1999; 10 (suppl 11): S149S161.[Medline] [Order article via Infotrieve]
35. Inagami T. Molecular biology and signaling of angiotensin receptors: an overview. J Am Soc Nephrol. 1999; 10 (suppl 11): S2S7.[Medline] [Order article via Infotrieve]
36. Hunyady L, Bor M, Balla T, Catt KJ. Identification of a cytoplasmic Ser-Thr-Leu motif that determines agonist-induced internalization of the AT1 angiotensin receptor. J Biol Chem. 1994; 269: 3137831382.
37. Efthymiadis A, Briggs LJ, Jans DA. The HIV-1 Tat nuclear localization sequence confers novel nuclear import properties. J Biol Chem. 1998; 273: 16231628.
38. Merjan AJ, Kanashiro CA, Krieger JE, Han SW, Paiva AC. Ligand-induced endocytosis and nuclear localization of angiotensin II receptors expressed in CHO cells. Braz J Med Biol Res. 2001; 34: 11751183.[Medline] [Order article via Infotrieve]
39. Lu D, Yang H, Shaw G, Raizada MK. Angiotensin IIinduced nuclear targeting of the angiotensin type 1 (AT1) receptor in brain neurons. Endocrinology. 1998; 139: 365375.
40. Booz GW, Conrad KM, Hess AL, Singer HA, Baker KM. Angiotensin-IIbinding sites on hepatocyte nuclei. Endocrinology. 1992; 130: 36413649.
41. Mi Z, Mai J, Lu X, Robbins PD. Characterization of a class of cationic peptides able to facilitate efficient protein transduction in vitro and in vivo. Mol Ther. 2000; 2: 339347.[CrossRef][Medline] [Order article via Infotrieve]
42. Gustafsson AB, Sayen MR, Williams SD, Crow MT, Gottlieb RA. TAT protein transduction into isolated perfused hearts: TAT-apoptosis repressor with caspase recruitment domain is cardioprotective. Circulation. 2002; 106: 735739.
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Hypertension Home | Subscriptions | Archives | Feedback | Authors | Help | AHA Journals Home | Search Copyright © 2003 American Heart Association, Inc. All rights reserved. Unauthorized use prohibited. |